DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and AT2G38730

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_181407.1 Gene:AT2G38730 / 818455 AraportID:AT2G38730 Length:199 Species:Arabidopsis thaliana


Alignment Length:166 Identity:91/166 - (54%)
Similarity:115/166 - (69%) Gaps:6/166 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELA---LKPQGE--GYKGSKFHRIIKDFMIQGG 90
            ||||::|||.|||||::.||....|||.|||::..   |:..|:  |||..:|||:|||||:|.|
plant    34 VFFDVSIGGIPAGRIKMELFADIAPKTAENFRQFCTGELRKAGKPLGYKECQFHRVIKDFMVQSG 98

  Fly    91 DFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVVFG 155
            ||.|.||:|..||||.:||||||..||.|.|.|||||:|.:|||.|||||..:..|||.:|||||
plant    99 DFLKNDGSGCMSIYGHKFEDENFTAKHTGPGLLSMANSGPNTNGCQFFITCAKCDWLDNKHVVFG 163

  Fly   156 KIL-SGMNVVRQIENSATDARDRPVKDVVIANSGTL 190
            ::| .|:.|:|:|||.|....:||...|||...|.:
plant   164 RVLGDGLLVMRKIENVAIGPNNRPKLAVVITECGEM 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 90/162 (56%)
AT2G38730NP_181407.1 PLN03149 14..199 CDD:178694 91/164 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.