DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and AT2G21130

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_179709.1 Gene:AT2G21130 / 816648 AraportID:AT2G21130 Length:174 Species:Arabidopsis thaliana


Alignment Length:168 Identity:96/168 - (57%)
Similarity:122/168 - (72%) Gaps:8/168 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEG-------YKGSKFHRIIKDFMI 87
            |||||:||||.|||:|.:.|:....|||.|||:.|....:|.|       :|||.|||:|.:||.
plant     6 KVFFDMTIGGAPAGKIVMELYTDKTPKTAENFRALCTGEKGVGRSGKPLHFKGSSFHRVIPNFMC 70

  Fly    88 QGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHV 152
            ||||||||:||||.||||.:||||||:.||.|.|.|||||||.:||||||||.|.:|.||||:||
plant    71 QGGDFTKGNGTGGESIYGAKFEDENFERKHTGPGILSMANAGANTNGSQFFICTVKTDWLDGKHV 135

  Fly   153 VFGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTL 190
            |||:::.|::||:.||...:.: .:|.|.||||:.|.:
plant   136 VFGQVVEGLDVVKAIEKIGSSS-GKPTKPVVIADCGEI 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 95/164 (58%)
AT2G21130NP_179709.1 cyclophilin_ABH_like 5..170 CDD:238907 95/164 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.