DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and SQN

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_565381.1 Gene:SQN / 816074 AraportID:AT2G15790 Length:361 Species:Arabidopsis thaliana


Alignment Length:170 Identity:96/170 - (56%)
Similarity:120/170 - (70%) Gaps:8/170 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEG--------YKGSKFHRIIKDFM 86
            |.|.||:||||..|||.|.|:...||||.|||:.|....:|.|        |||::|||:||.||
plant     5 KCFMDISIGGELEGRIVIELYDDVVPKTAENFRLLCTGEKGLGPNTGVPLHYKGNRFHRVIKGFM 69

  Fly    87 IQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRH 151
            |||||.:..|||||.||||.:|:||||:|||...|.|||||:|.:||||||||||.:||.|||:|
plant    70 IQGGDISANDGTGGESIYGLKFDDENFELKHERKGMLSMANSGPNTNGSQFFITTTRTSHLDGKH 134

  Fly   152 VVFGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTLP 191
            ||||::..||.|||.||:.:.:.:..|.:||||.:.|.:|
plant   135 VVFGRVTKGMGVVRSIEHVSIEEQSCPSQDVVIHDCGEIP 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 94/165 (57%)
SQNNP_565381.1 cyclophilin_ABH_like 4..171 CDD:238907 94/165 (57%)
TPR_11 216..329 CDD:290150
TPR repeat 263..293 CDD:276809
TPR_2 298..331 CDD:285020
TPR repeat 298..326 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.