DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and ppil4

DIOPT Version :10

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001122114.1 Gene:ppil4 / 733774 XenbaseID:XB-GENE-975086 Length:471 Species:Xenopus tropicalis


Alignment Length:163 Identity:63/163 - (38%)
Similarity:88/163 - (53%) Gaps:18/163 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRIIKDFMIQGGDFTKG 95
            |..:.|:|.     |.|.|:.:..|:...||.:|.   :.:.|.....|.:.|||:||.||.| |
 Frog     3 VLLETTLGD-----IVIDLYTEERPRACLNFLKLC---KIKYYNYCLIHSVQKDFIIQTGDPT-G 58

  Fly    96 DGTGGRS----IYGER---FEDENF-KLKHYGAGWLSMANAGKDTNGSQFFITT-KQTSWLDGRH 151
            .|.||.|    |||::   ||.|.. ::||...|.:||.|.|.|.:||||.||| :...:|||.|
 Frog    59 TGRGGESLYCKIYGDQAKFFESEKVPRIKHKKFGTVSMVNNGNDQHGSQFLITTGENLDYLDGVH 123

  Fly   152 VVFGKILSGMNVVRQIENSATDARDRPVKDVVI 184
            .|||::..|||||::|..:..|....|.:|:.|
 Frog   124 TVFGEVTEGMNVVKKINEAFVDKEFVPYQDIRI 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:469651 63/163 (39%)
ppil4NP_001122114.1 cyclophilin_RRM 4..169 CDD:238902 62/162 (38%)
RRM_PPIL4 237..319 CDD:409681
U2AF_lg 368..>468 CDD:273727
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.