DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and Ppil6

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_082706.1 Gene:Ppil6 / 73075 MGIID:1920325 Length:313 Species:Mus musculus


Alignment Length:167 Identity:69/167 - (41%)
Similarity:96/167 - (57%) Gaps:8/167 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEG-------YKGSKFHRIIKDFMIQ 88
            |:.||.|...|.||:...|:....|:|..||:.|.....|..       ||.|.|||::::..||
Mouse   146 VYLDICIDLSPIGRLIFELYCDACPRTCTNFQVLCTGTSGFSERGTKLHYKDSIFHRVVQNGWIQ 210

  Fly    89 GGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVV 153
            |||..:|.|..|.||||..||||||.:.|...|.|.|.|.|..||||||:||.:...:||.::|.
Mouse   211 GGDIVQGRGDDGESIYGPTFEDENFSIPHNKRGVLGMVNKGHHTNGSQFYITLQAAPYLDKKYVA 275

  Fly   154 FGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTL 190
            ||:::.|.:|::|:|...|: .:||:....||:||.|
Mouse   276 FGQLIEGTHVLKQLELVPTE-NERPLLLCSIADSGVL 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 66/163 (40%)
Ppil6NP_082706.1 cyclophilin 146..309 CDD:294131 66/163 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.