DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and Ppil6

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:XP_017457315.1 Gene:Ppil6 / 685567 RGDID:1592581 Length:332 Species:Rattus norvegicus


Alignment Length:175 Identity:67/175 - (38%)
Similarity:93/175 - (53%) Gaps:22/175 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEG-------YKGSKFHRIIKDFMIQ 88
            ||.||:|...|.||:...|:....|:|..||:.|.....|..       ||.|.|||::|:..:|
  Rat   146 VFLDISIDLAPIGRLIFELYCDACPRTCTNFQVLCTGTSGFSERGIKLHYKDSIFHRVVKNGWVQ 210

  Fly    89 GGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVV 153
            |||..:|.|..|.||||..||||||.:.|...|.|.|.|.|..||||||:||.:.|.:||.::|.
  Rat   211 GGDIVEGRGDDGESIYGPTFEDENFSVPHNKRGVLGMVNKGHHTNGSQFYITLQATPYLDKKYVA 275

  Fly   154 FGKILSGMNVVRQIENSATDARDRPVKDVVIANSGT-LPVSEAFS 197
            |     |::.:..:.:         :.|.:|.:||| :.:.||.|
  Rat   276 F-----GLHSILYMPH---------LHDDIIPHSGTYVNIREAVS 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 61/163 (37%)
Ppil6XP_017457315.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.