DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and Ppil4

DIOPT Version :10

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_080417.2 Gene:Ppil4 / 67418 MGIID:1914668 Length:492 Species:Mus musculus


Alignment Length:163 Identity:57/163 - (34%)
Similarity:89/163 - (54%) Gaps:18/163 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRIIKDFMIQGGDFTKG 95
            |..:.|:|.     :.|.|:.:..|:...||.:|.   :.:.|.....|.:.:||:||.||.| |
Mouse     3 VLLETTLGD-----VVIDLYTEERPRACLNFLKLC---KIKYYNYCLIHNVQRDFIIQTGDPT-G 58

  Fly    96 DGTGGRSIYGERFEDE-NF-------KLKHYGAGWLSMANAGKDTNGSQFFITT-KQTSWLDGRH 151
            .|.||.||:|:.:.|: :|       ::||...|.:||.|.|.|.:||||.||| :...:|||.|
Mouse    59 TGRGGESIFGQLYGDQASFFEAEKVPRIKHKKKGTVSMVNNGSDQHGSQFLITTGENLDYLDGVH 123

  Fly   152 VVFGKILSGMNVVRQIENSATDARDRPVKDVVI 184
            .|||::..||::|::|..:..|....|.:|:.|
Mouse   124 TVFGEVTEGMDIVKKINETFVDKDFVPYQDIRI 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:469651 57/163 (35%)
Ppil4NP_080417.2 cyclophilin_RRM 4..161 CDD:238902 56/162 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..188
RRM_PPIL4 237..319 CDD:409681
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 368..409
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 423..492
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.