DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and Cwc27

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001347023.1 Gene:Cwc27 / 67285 MGIID:1914535 Length:472 Species:Mus musculus


Alignment Length:157 Identity:63/157 - (40%)
Similarity:86/157 - (54%) Gaps:13/157 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PKVTEKVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRIIKDFMIQG 89
            |....||....|     ||.|:|.|:.|..||...||.:|.|:..   |..:.|||::..|::||
Mouse     9 PPTNGKVLLKTT-----AGDIDIELWSKEAPKACRNFIQLCLEAY---YDNTIFHRVVPGFIVQG 65

  Fly    90 GDFTKGDGTGGRSIYGERFEDE-NFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVV 153
            ||.| |.||||.||||..|:|| :.:|:....|.::|||||...||||||.|..:...|:.:|.:
Mouse    66 GDPT-GTGTGGESIYGAPFKDEFHSRLRFNRRGLVAMANAGPHDNGSQFFFTLGRADELNNKHTI 129

  Fly   154 FGKILSG--MNVVRQIENSATDARDRP 178
            |||:...  .|::|..|....| .:||
Mouse   130 FGKVTGDTVYNMLRLTEVDIDD-EERP 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 62/152 (41%)
Cwc27NP_001347023.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 63/157 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 431..472
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.