DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and Ppil2

DIOPT Version :10

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:XP_006522510.1 Gene:Ppil2 / 66053 MGIID:2447857 Length:564 Species:Mus musculus


Alignment Length:158 Identity:69/158 - (43%)
Similarity:100/158 - (63%) Gaps:10/158 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRIIKDFMIQGGDFTKGDGTGGRSIYGER 107
            |.:.:.|.....|||.|||.:|..|   :.|.|:.|||.|::|:|||||.| |.||||.|.:|:.
Mouse   289 GDLNLELHCDLTPKTCENFIKLCKK---QYYDGTIFHRSIRNFVIQGGDPT-GTGTGGESFWGKP 349

  Fly   108 FEDENFK--LKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVVFGKILSGMNVVRQIENS 170
            |:|| |:  |.|.|.|.|||||:|.:||.||||||.:..::||.:|.:||:::.|.:.:..:||.
Mouse   350 FKDE-FRPNLSHTGRGVLSMANSGPNTNKSQFFITFRSCAYLDKKHTIFGRVVGGFDTLTAMENV 413

  Fly   171 ATDAR-DRPVKDVVIANSGTL--PVSEA 195
            .:|.: |||.::|:|..:...  |..||
Mouse   414 ESDPKTDRPKEEVLICTTTVFVDPYEEA 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:469651 66/147 (45%)
Ppil2XP_006522510.1 RING-Ubox_PPIL2 38..110 CDD:438325
RING_Ubox 101..159 CDD:473075
cyclophilin_RING 281..440 CDD:238904 67/155 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.