DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and PPIAL4C

DIOPT Version :10

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001129261.2 Gene:PPIAL4C / 653598 HGNCID:33995 Length:164 Species:Homo sapiens


Alignment Length:167 Identity:92/167 - (55%)
Similarity:113/167 - (67%) Gaps:11/167 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VTEKVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRIIKDFMIQGGD 91
            |...||||||:.|:|.|||.|.||...:|||.|||:.|:...:|..||||.|||||..||.||||
Human     2 VNSVVFFDITVDGKPLGRISIKLFADKIPKTAENFRALSTGEKGFRYKGSCFHRIIPGFMCQGGD 66

  Fly    92 FTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVVFGK 156
            ||:.:|||.:|||||:|:|||...||.|:|.|||||||.:||||||||.|.:|.||||:||.|||
Human    67 FTRPNGTGDKSIYGEKFDDENLIRKHTGSGILSMANAGPNTNGSQFFICTAKTEWLDGKHVAFGK 131

  Fly   157 ILSGMNVVRQIE-----NSATDARDRPVKDVVIANSG 188
            :...:|:|..:|     ||.|.      |.:.||:.|
Human   132 VKERVNIVEAMEHFGYRNSKTS------KKITIADCG 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:469651 90/162 (56%)
PPIAL4CNP_001129261.2 cyclophilin 4..162 CDD:469651 90/163 (55%)

Return to query results.
Submit another query.