DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and PPIAL4G

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001116540.1 Gene:PPIAL4G / 644591 HGNCID:33996 Length:164 Species:Homo sapiens


Alignment Length:167 Identity:90/167 - (53%)
Similarity:111/167 - (66%) Gaps:11/167 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VTEKVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRIIKDFMIQGGD 91
            |...:|||||:.|:|.|||.|..|...:|||.|||:.|:...:|..||||.|||||..||.||||
Human     2 VNSVIFFDITVDGKPLGRISIKQFADKIPKTAENFRALSTGEKGFRYKGSCFHRIIPGFMCQGGD 66

  Fly    92 FTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVVFGK 156
            ||..:|||.:|||||:|:|||...||.|:|.|||||||.:||||||||.|.:|.||||:||.|||
Human    67 FTHPNGTGDKSIYGEKFDDENLIRKHTGSGILSMANAGPNTNGSQFFICTAKTEWLDGKHVAFGK 131

  Fly   157 ILSGMNVVRQIE-----NSATDARDRPVKDVVIANSG 188
            :...:|:|..:|     ||.|.      |.:.||:.|
Human   132 VKERVNIVEAMEHFGYRNSKTS------KKITIADCG 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 88/162 (54%)
PPIAL4GNP_001116540.1 cyclophilin 4..162 CDD:294131 88/163 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.