DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and Ppib

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_071981.1 Gene:Ppib / 64367 RGDID:620312 Length:208 Species:Rattus norvegicus


Alignment Length:204 Identity:136/204 - (66%)
Similarity:162/204 - (79%) Gaps:10/204 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VFVVALVAGVVV----------ADDSKGPKVTEKVFFDITIGGEPAGRIEIGLFGKTVPKTVENF 61
            :|..||:.|.||          .|..||||||.||:||..||.||.||:..|||||||||||:||
  Rat     4 LFAAALIVGSVVFLLLPGPSVANDKKKGPKVTVKVYFDFQIGDEPVGRVTFGLFGKTVPKTVDNF 68

  Fly    62 KELALKPQGEGYKGSKFHRIIKDFMIQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMA 126
            ..||...:|.|||.|||||:||||||||||||:||||||:|||||||.||||||||||.||:|||
  Rat    69 VALATGEKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMA 133

  Fly   127 NAGKDTNGSQFFITTKQTSWLDGRHVVFGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTLP 191
            |||||||||||||||.:||||||:||||||:|.||:|||::||:.||:||:|:|||:|.:.|.:.
  Rat   134 NAGKDTNGSQFFITTVKTSWLDGKHVVFGKVLEGMDVVRKVENTKTDSRDKPLKDVIIVDCGKIE 198

  Fly   192 VSEAFSVAK 200
            |.:.|::||
  Rat   199 VEKPFAIAK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 118/157 (75%)
PpibNP_071981.1 cyclophilin_ABH_like 37..195 CDD:238907 118/157 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 255 1.000 Domainoid score I1981
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H726
Inparanoid 1 1.050 287 1.000 Inparanoid score I2760
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 1 1.000 - - oto96344
orthoMCL 1 0.900 - - OOG6_100844
Panther 1 1.100 - - LDO PTHR11071
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X987
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.