DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and ppifb

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001032199.2 Gene:ppifb / 641328 ZFINID:ZDB-GENE-051030-126 Length:192 Species:Danio rerio


Alignment Length:161 Identity:94/161 - (58%)
Similarity:110/161 - (68%) Gaps:3/161 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRIIKDFMIQGGDFTKG 95
            |||||....:|.||:...|....||||.|||:.|.....|.|||||.|||:|..||.||||||..
Zfish    33 VFFDIAADNQPLGRVTFELNADVVPKTAENFRALCTGEHGFGYKGSIFHRVIPQFMCQGGDFTNH 97

  Fly    96 DGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVVFGKILSG 160
            :||||:||||.||.||||||||.|.|.|||||||.:||||||||.|.:|.||||||||||.:..|
Zfish    98 NGTGGKSIYGPRFPDENFKLKHTGPGILSMANAGVNTNGSQFFICTAKTEWLDGRHVVFGSVKEG 162

  Fly   161 MNVVRQIENSATDARD-RPVKDVVIANSGTL 190
            |:|||::|  |..:|. |..:.:.|.:.|.|
Zfish   163 MDVVRKVE--ALGSRSGRTAQRISITDCGEL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 92/157 (59%)
ppifbNP_001032199.2 cyclophilin_ABH_like 31..189 CDD:238907 92/157 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.