DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and Ppie

DIOPT Version :10

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_062362.1 Gene:Ppie / 56031 MGIID:1917118 Length:301 Species:Mus musculus


Alignment Length:168 Identity:92/168 - (54%)
Similarity:123/168 - (73%) Gaps:3/168 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SKGPKVTEKVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRIIKDFM 86
            :|..:...:|:.||.||.:|||||::.|....||.|.|||:.|....:|.|:|||.|||||..||
Mouse   133 AKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFM 197

  Fly    87 IQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRH 151
            .||||||..:||||:||||::|:||||.|||.|.|.|||||:|.:|||||||:|..:|.||||:|
Mouse   198 CQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKH 262

  Fly   152 VVFGKILSGMNVVRQIENSATDARD-RPVKDVVIANSG 188
            ||||::..|::|:||||  |..::| :|.:.|:||:.|
Mouse   263 VVFGEVTEGLDVLRQIE--AQGSKDGKPKQKVMIADCG 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:469651 90/158 (57%)
PpieNP_062362.1 RRM_PPIE 8..82 CDD:409783
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..141 1/7 (14%)
cyclophilin_ABH_like 140..298 CDD:238907 90/159 (57%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.