DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and ppib

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001017063.1 Gene:ppib / 549817 XenbaseID:XB-GENE-855964 Length:208 Species:Xenopus tropicalis


Alignment Length:210 Identity:141/210 - (67%)
Similarity:167/210 - (79%) Gaps:13/210 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFLSVFVVALVAGVV---------VADD-SKGPKVTEKVFFDITIGGEPAGRIEIGLFGKTVP 55
            |||.::   .||:||.|         |||: .||||||.||:|||.||.|..||:.|||||||||
 Frog     1 MKLLVA---AALIAGSVIFLLFPGSSVADEKKKGPKVTHKVYFDIKIGDEDVGRVVIGLFGKTVP 62

  Fly    56 KTVENFKELALKPQGEGYKGSKFHRIIKDFMIQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGA 120
            ||||||..||...:|.|||||||||:||||||||||||:||||||:||||:||.||||||:|||.
 Frog    63 KTVENFVTLATGEKGFGYKGSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGDRFPDENFKLRHYGP 127

  Fly   121 GWLSMANAGKDTNGSQFFITTKQTSWLDGRHVVFGKILSGMNVVRQIENSATDARDRPVKDVVIA 185
            .|:||||||||||||||||||.:|.||||:||||||||.|.:||.:||::.||.||:|:||||||
 Frog   128 NWVSMANAGKDTNGSQFFITTVKTPWLDGKHVVFGKILEGKDVVEKIESTKTDGRDKPLKDVVIA 192

  Fly   186 NSGTLPVSEAFSVAK 200
            :.||:.|.:.|::||
 Frog   193 DCGTIEVEKPFAIAK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 118/157 (75%)
ppibNP_001017063.1 cyclophilin_ABH_like 36..195 CDD:238907 118/158 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H726
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11071
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.