DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and PPIC

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_000934.1 Gene:PPIC / 5480 HGNCID:9256 Length:212 Species:Homo sapiens


Alignment Length:180 Identity:122/180 - (67%)
Similarity:136/180 - (75%) Gaps:0/180 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KGPKVTEKVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRIIKDFMI 87
            :||.||.|||||:.||.:..|||.||||||.||||||||..||...:|.|||||||||:||||||
Human    32 RGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYGYKGSKFHRVIKDFMI 96

  Fly    88 QGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHV 152
            ||||.|.||||||.|||||.|.||||||||||.||:||||||.||||||||||..:.:||||:||
Human    97 QGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHV 161

  Fly   153 VFGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTLPVSEAFSVAKAD 202
            ||||::.||.||..||..|||..|||:.:..|.|||.:.|...|.|..||
Human   162 VFGKVIDGMTVVHSIELQATDGHDRPLTNCSIINSGKIDVKTPFVVEIAD 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 111/157 (71%)
PPICNP_000934.1 cyclophilin 39..197 CDD:294131 111/157 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 1 1.000 - - otm40844
orthoMCL 1 0.900 - - OOG6_100844
Panther 1 1.100 - - O PTHR11071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X987
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.790

Return to query results.
Submit another query.