DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and PPIL1

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_057143.1 Gene:PPIL1 / 51645 HGNCID:9260 Length:166 Species:Homo sapiens


Alignment Length:143 Identity:80/143 - (55%)
Similarity:101/143 - (70%) Gaps:5/143 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRIIKDFMIQGGDFTKGDGTGGRSIYGER 107
            |.|.:.|:.|..|||.:||.|||.:..   |.|:|||||||||||||||.| |.|.||.||||::
Human    21 GIIVLELYWKHAPKTCKNFAELARRGY---YNGTKFHRIIKDFMIQGGDPT-GTGRGGASIYGKQ 81

  Fly   108 FEDE-NFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVVFGKILSGMNVVRQIENSA 171
            |||| :..||..|||.|:|||||.||||||||:|...|.||||:|.:||::..|:.:|.::....
Human    82 FEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVE 146

  Fly   172 TDARDRPVKDVVI 184
            |:::||||.||.|
Human   147 TNSQDRPVDDVKI 159

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 80/143 (56%)
PPIL1NP_057143.1 cyclophilin_SpCYP2_like 15..161 CDD:238903 80/143 (56%)
Cyclosporin A binding. /evidence=ECO:0000305|PubMed:16595688 54..65 10/10 (100%)