DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and ppif

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001244029.1 Gene:ppif / 493394 XenbaseID:XB-GENE-1008626 Length:200 Species:Xenopus tropicalis


Alignment Length:180 Identity:94/180 - (52%)
Similarity:117/180 - (65%) Gaps:1/180 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ALVAGVVVADDSKGPKVTEKVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYKG 75
            :.||....:|.|..||....|:.|:....:|.||:...|....||||.|||:.|....:|.||||
 Frog    21 SFVASRASSDWSGLPKKNPMVYMDLVADNQPLGRVTFELRADVVPKTAENFRALCTGEKGFGYKG 85

  Fly    76 SKFHRIIKDFMIQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFIT 140
            |.|||||.:||.||||||..:||||:||||.||.||||.|||.|.|.:||||||.:||||||||.
 Frog    86 STFHRIIPNFMCQGGDFTNHNGTGGKSIYGSRFPDENFFLKHTGPGVVSMANAGPNTNGSQFFIC 150

  Fly   141 TKQTSWLDGRHVVFGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTL 190
            |.:|.|||.:|||||.|..|.:::::||:..:.. .||.|.||:|..|.|
 Frog   151 TVETEWLDNKHVVFGCIKDGYDIMKKIESFGSKT-GRPSKKVVVAECGEL 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 86/157 (55%)
ppifNP_001244029.1 cyclophilin_ABH_like 39..197 CDD:238907 86/158 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.