DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and ppig

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001001234.1 Gene:ppig / 407915 XenbaseID:XB-GENE-5805534 Length:736 Species:Xenopus tropicalis


Alignment Length:176 Identity:98/176 - (55%)
Similarity:116/176 - (65%) Gaps:9/176 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GPKVTE-KVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEG--------YKGSKFH 79
            |.||.. :.||||.|...||||:...||....|||.|||:.|....:|.|        ||...||
 Frog     2 GVKVQRTRCFFDIAINNAPAGRVVFELFSDVCPKTCENFRSLCTGERGIGKSTQKPLHYKNCMFH 66

  Fly    80 RIIKDFMIQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQT 144
            |::||||||||||::|:|.||.||||..||||||.::|.....|||||.||||||||||||||.|
 Frog    67 RVVKDFMIQGGDFSEGNGRGGESIYGGFFEDENFSIQHNKEFLLSMANRGKDTNGSQFFITTKPT 131

  Fly   145 SWLDGRHVVFGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTL 190
            ..|||.|||||:::||.::||:|||..|||..:|..||.|.|.|.|
 Frog   132 PHLDGLHVVFGQVISGQDLVREIENQKTDASSKPSVDVSIQNCGEL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 93/165 (56%)
ppigNP_001001234.1 cyclophilin_ABH_like 9..175 CDD:238907 93/165 (56%)
DUF4603 403..>563 CDD:292020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.