DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and cwc27

DIOPT Version :10

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_957397.1 Gene:cwc27 / 394078 ZFINID:ZDB-GENE-040426-1118 Length:470 Species:Danio rerio


Alignment Length:153 Identity:63/153 - (41%)
Similarity:92/153 - (60%) Gaps:10/153 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 AGRIEIGLFGKTVPKTVENFKELALKPQGEG-YKGSKFHRIIKDFMIQGGDFTKGDGTGGRSIYG 105
            ||.|:|.|:.|..||...||.:|.:    || |.|:.|||::.:|::||||.| |.||||.||||
Zfish    21 AGDIDIELWSKETPKACRNFVQLCM----EGYYDGTIFHRMVPEFIVQGGDPT-GTGTGGESIYG 80

  Fly   106 ERFEDE-NFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVVFGKILSG--MNVVRQI 167
            ..|:|| :.:|:....|.::|||||...||||||.|..:...|:.:|.:|||:...  .|::| :
Zfish    81 RPFKDEFHSRLRFNRRGLVAMANAGPHDNGSQFFFTLGRADELNNKHTIFGKVTGDTVYNMLR-L 144

  Fly   168 ENSATDARDRPVKDVVIANSGTL 190
            .:.|.|..:||:....|.::..|
Zfish   145 ADVACDGDERPLNPHKIRSTEVL 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:469651 62/149 (42%)
cwc27NP_957397.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 63/153 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 172..377
PTZ00121 <274..>468 CDD:173412
CWC27_CTD 371..426 CDD:412084
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 428..470
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.