DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and cwc27

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_957397.1 Gene:cwc27 / 394078 ZFINID:ZDB-GENE-040426-1118 Length:470 Species:Danio rerio


Alignment Length:153 Identity:63/153 - (41%)
Similarity:92/153 - (60%) Gaps:10/153 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 AGRIEIGLFGKTVPKTVENFKELALKPQGEG-YKGSKFHRIIKDFMIQGGDFTKGDGTGGRSIYG 105
            ||.|:|.|:.|..||...||.:|.:    || |.|:.|||::.:|::||||.| |.||||.||||
Zfish    21 AGDIDIELWSKETPKACRNFVQLCM----EGYYDGTIFHRMVPEFIVQGGDPT-GTGTGGESIYG 80

  Fly   106 ERFEDE-NFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVVFGKILSG--MNVVRQI 167
            ..|:|| :.:|:....|.::|||||...||||||.|..:...|:.:|.:|||:...  .|::| :
Zfish    81 RPFKDEFHSRLRFNRRGLVAMANAGPHDNGSQFFFTLGRADELNNKHTIFGKVTGDTVYNMLR-L 144

  Fly   168 ENSATDARDRPVKDVVIANSGTL 190
            .:.|.|..:||:....|.::..|
Zfish   145 ADVACDGDERPLNPHKIRSTEVL 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 62/149 (42%)
cwc27NP_957397.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 63/153 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 172..377
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 428..470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.