DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and CG8336

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001261636.1 Gene:CG8336 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster


Alignment Length:182 Identity:79/182 - (43%)
Similarity:110/182 - (60%) Gaps:9/182 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEG-------YKGSKFHRIIKDFMIQ 88
            |:.||:||.|.|||:.|.|....||||.|||:.|.....|.|       |||:|||:|.:.|::|
  Fly    17 VYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTKFHKIKRVFVVQ 81

  Fly    89 GGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGK-DTNGSQFFITTKQTSWLDGRHV 152
            .||..|.||:.|.||||..|:||||:|.|...|.:||||.|| ::|.|||||:......|:|.:|
  Fly    82 SGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGKPNSNNSQFFISAAGCENLNGTNV 146

  Fly   153 VFGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTLPVSEAFSVAKADAT 204
            |.|::|.|:.:|.::|.:.||..| |...:||.:.|.:..:|.:.:...|.|
  Fly   147 VVGRVLRGLGIVAEMEQNCTDEGD-PTAPIVIRDCGEIAHNEDWGIECNDET 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 75/164 (46%)
CG8336NP_001261636.1 cyclophilin 15..181 CDD:294131 75/164 (46%)
TPR repeat 285..315 CDD:276809
TPR_19 300..369 CDD:291240
TPR_1 320..353 CDD:278916
TPR repeat 320..346 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447198
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.