DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and CG7747

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster


Alignment Length:192 Identity:77/192 - (40%)
Similarity:119/192 - (61%) Gaps:15/192 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VALVAGVVVADD-SKGPKVTEKVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGY 73
            |:.:...::.|| .|..:|.:|.:..:...   .|.:.:.||....|:..:||    :|....||
  Fly   258 VSQIEAAIIDDDLVKYERVKKKGYVRLNTN---LGPLNLELFCDQTPRACDNF----IKHCANGY 315

  Fly    74 KGS-KFHRIIKDFMIQGGDFTKGDGTGGRSIYGERFEDENFK--LKHYGAGWLSMANAGKDTNGS 135
            ..: .|||.|::|::||||.| |.|:||.||:|::|||| ||  |.|.|.|.|||||:|.:||||
  Fly   316 YNNVMFHRSIRNFIVQGGDPT-GSGSGGESIWGKKFEDE-FKPNLTHTGRGVLSMANSGPNTNGS 378

  Fly   136 QFFITTKQTSWLDGRHVVFGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTL--PVSEA 195
            |||||.:....|||:|.:|||::.|::.::::||...|.:|||::|::|.:|...  |.:||
  Fly   379 QFFITYRSCKHLDGKHTIFGKLVGGLDTLQKMENIEVDNKDRPIEDIIIESSQVFVNPFAEA 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 68/160 (43%)
CG7747NP_611113.1 RING 25..238 CDD:302633
cyclophilin_RING 281..439 CDD:238904 69/166 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447180
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.