DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and Ppih

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:XP_003750067.2 Gene:Ppih / 366461 RGDID:1564921 Length:177 Species:Rattus norvegicus


Alignment Length:183 Identity:98/183 - (53%)
Similarity:120/183 - (65%) Gaps:14/183 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VVVADDSKGPKVTEKVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGE--------G 72
            :.||:.|   .|...||||::|||:..||::|.||...||||.|||::..   .||        |
  Rat     1 MAVANSS---PVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFC---TGEFRKDGVPIG 59

  Fly    73 YKGSKFHRIIKDFMIQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQF 137
            ||||.|||:|||||||||||..|||||..|||...|.||||||:|...|.|||||:|..|||.||
  Rat    60 YKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQF 124

  Fly   138 FITTKQTSWLDGRHVVFGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTL 190
            |||..:..||||:|||||||:.|:.|:|:|||..|...::|...|||:..|.:
  Rat   125 FITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 93/165 (56%)
PpihXP_003750067.2 cyclophilin 8..177 CDD:412213 95/171 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.