DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and Cwc27

DIOPT Version :10

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:XP_017446439.1 Gene:Cwc27 / 361887 RGDID:1310697 Length:471 Species:Rattus norvegicus


Alignment Length:157 Identity:62/157 - (39%)
Similarity:86/157 - (54%) Gaps:13/157 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PKVTEKVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRIIKDFMIQG 89
            |....||....|     ||.|:|.|:.|..||...||.:|.|:..   |..:.|||::..|::||
  Rat     9 PPTNGKVLLKTT-----AGDIDIELWSKEAPKACRNFIQLCLEAY---YDNTIFHRVVPGFIVQG 65

  Fly    90 GDFTKGDGTGGRSIYGERFEDE-NFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVV 153
            ||.| |.||||.|:||..|:|| :.:|:....|.::|||||...||||||.|..:...|:.:|.:
  Rat    66 GDPT-GTGTGGESVYGAPFKDEFHSRLRFNRRGLVAMANAGPHDNGSQFFFTLGRADELNNKHTI 129

  Fly   154 FGKILSG--MNVVRQIENSATDARDRP 178
            |||:...  .|::|..|....| .:||
  Rat   130 FGKVTGDTVYNMLRLTEVDIDD-EERP 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:469651 61/152 (40%)
Cwc27XP_017446439.1 cyclophilin_CeCYP16-like 8..177 CDD:238906 62/157 (39%)
PTZ00121 <278..>467 CDD:173412
CWC27_CTD 376..427 CDD:412084
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.