DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and Ppial4g

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:XP_341364.2 Gene:Ppial4g / 361080 RGDID:1559682 Length:195 Species:Rattus norvegicus


Alignment Length:163 Identity:87/163 - (53%)
Similarity:111/163 - (68%) Gaps:1/163 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRIIKDFMIQGGDFTKG 95
            :||:||..|||.||:.:.||...||:|.|||:.|....:|.|||||.|||||..||.|||..|..
  Rat     6 MFFNITADGEPLGRVSLELFADKVPRTAENFRSLTTGEKGFGYKGSSFHRIIPGFMCQGGKVTCH 70

  Fly    96 DGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVVFGKILSG 160
            :||||:|||||:||:::|.|||.|.|.|||||||.:||||||||.|.:|..|||:.|||||...|
  Rat    71 NGTGGKSIYGEKFENDSFILKHTGPGILSMANAGPNTNGSQFFICTAKTERLDGKCVVFGKGRGG 135

  Fly   161 MNVVRQIENSATDARDRPVKDVVIANSGTLPVS 193
            .|:|..:|:..: ...:..|.:.|::.|.|.||
  Rat   136 TNIVEAMEHFGS-RNGKTSKKITISDCGQLLVS 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 83/156 (53%)
Ppial4gXP_341364.2 cyclophilin 7..162 CDD:294131 83/155 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.