DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and ppiab

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001315353.1 Gene:ppiab / 335519 ZFINID:ZDB-GENE-030131-7459 Length:164 Species:Danio rerio


Alignment Length:161 Identity:99/161 - (61%)
Similarity:116/161 - (72%) Gaps:1/161 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRIIKDFMIQGGDFTK 94
            ||||||||.|:.||||.:.|....||||.|||:.|....:|.|||||.|||:|..||.||||||.
Zfish     5 KVFFDITIDGKEAGRIVMELRADVVPKTAENFRALCTGEKGFGYKGSGFHRVIPQFMCQGGDFTN 69

  Fly    95 GDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVVFGKILS 159
            .:||||:||||.:||||||.|||.|.|.|||||||.:||||||||.|..|:||||:||||||::.
Zfish    70 HNGTGGKSIYGNKFEDENFTLKHGGKGTLSMANAGPNTNGSQFFICTADTNWLDGKHVVFGKVVD 134

  Fly   160 GMNVVRQIENSATDARDRPVKDVVIANSGTL 190
            |::||..||...:.:.....| |||||.|.|
Zfish   135 GLDVVDAIEKKGSSSGKCSAK-VVIANCGQL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 97/157 (62%)
ppiabNP_001315353.1 cyclophilin_ABH_like 4..162 CDD:238907 97/157 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579535
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.