DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and ninaA

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster


Alignment Length:171 Identity:83/171 - (48%)
Similarity:112/171 - (65%) Gaps:3/171 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VTEKVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKP-QGEGYKGSKFHRIIKDFMIQGG 90
            ||.:::.|:....:|.|||..|||||..||||.||:.:.|:. .|..|.||:|||::..|::|||
  Fly    25 VTSRIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICLRGINGTSYVGSRFHRVVDRFLVQGG 89

  Fly    91 DFTKGDGTGGRSIYGERFEDEN--FKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVV 153
            |...|||||..||||:.|.||:  ..::|...|:|.|||.|.||||.||::||....||||:|.|
  Fly    90 DIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGKHTV 154

  Fly   154 FGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTLPVSE 194
            |||:|.||:.:..||:..||..|.||:.|||:|.|.:|..:
  Fly   155 FGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCGEIPTEQ 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 79/160 (49%)
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 79/161 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I362
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105337at33392
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.