DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and Ppie

DIOPT Version :10

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001382655.1 Gene:Ppie / 298508 RGDID:1311411 Length:301 Species:Rattus norvegicus


Alignment Length:168 Identity:93/168 - (55%)
Similarity:123/168 - (73%) Gaps:3/168 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SKGPKVTEKVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRIIKDFM 86
            :|..:...:|:.||.||.:|||||::.|....||.|.|||:.|....:|.|:|||.|||||..||
  Rat   133 AKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFM 197

  Fly    87 IQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRH 151
            .||||||..:||||:||||::|:||||.|||.|.|.|||||:|.:|||||||:|..:|.||||:|
  Rat   198 CQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKH 262

  Fly   152 VVFGKILSGMNVVRQIENSATDARD-RPVKDVVIANSG 188
            ||||:|..|::|:||||  |..::| :|.:.|:||:.|
  Rat   263 VVFGEITDGLDVLRQIE--AQGSKDGKPKQKVIIADCG 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:469651 91/158 (58%)
PpieNP_001382655.1 RRM_PPIE 8..82 CDD:409783
cyclophilin_ABH_like 140..298 CDD:238907 91/159 (57%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.