DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and Ppie

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001382655.1 Gene:Ppie / 298508 RGDID:1311411 Length:301 Species:Rattus norvegicus


Alignment Length:168 Identity:93/168 - (55%)
Similarity:123/168 - (73%) Gaps:3/168 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SKGPKVTEKVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRIIKDFM 86
            :|..:...:|:.||.||.:|||||::.|....||.|.|||:.|....:|.|:|||.|||||..||
  Rat   133 AKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFM 197

  Fly    87 IQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRH 151
            .||||||..:||||:||||::|:||||.|||.|.|.|||||:|.:|||||||:|..:|.||||:|
  Rat   198 CQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKH 262

  Fly   152 VVFGKILSGMNVVRQIENSATDARD-RPVKDVVIANSG 188
            ||||:|..|::|:||||  |..::| :|.:.|:||:.|
  Rat   263 VVFGEITDGLDVLRQIE--AQGSKDGKPKQKVIIADCG 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 91/158 (58%)
PpieNP_001382655.1 RRM_PPIE 8..82 CDD:409783
cyclophilin_ABH_like 140..298 CDD:238907 91/159 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.