DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and Ppwd1

DIOPT Version :10

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001099876.1 Gene:Ppwd1 / 294711 RGDID:1310204 Length:646 Species:Rattus norvegicus


Alignment Length:173 Identity:83/173 - (47%)
Similarity:101/173 - (58%) Gaps:10/173 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VVVADDSKGPKVTEKVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHR 80
            |:.|..::|||...    |..|.....|.|.|.||....|||||||   .:..:...|.|..|||
  Rat   478 VMAATQAEGPKRVS----DSAIVHTSMGDIHIKLFPVECPKTVENF---CVHSRNGYYNGHTFHR 535

  Fly    81 IIKDFMIQGGDFTKGDGTGGRSIYGERFEDE-NFKLKHYGAGWLSMANAGKDTNGSQFFITTKQT 144
            |||.||||.||.| |.|.||.||:|..|||| :..|:|.....|||||||.:|||||||||...|
  Rat   536 IIKGFMIQTGDPT-GTGMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNGSQFFITVVPT 599

  Fly   145 SWLDGRHVVFGKILSGMNVVRQIENSATDAR-DRPVKDVVIAN 186
            .|||.:|.|||::..||.||::|.|...:.: |:|.:||.|.|
  Rat   600 PWLDNKHTVFGRVTKGMEVVQRISNVKVNPKTDKPYEDVSIIN 642

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:469651 78/159 (49%)
Ppwd1NP_001099876.1 WD40 <89..319 CDD:441893
WD40 repeat 136..177 CDD:293791
WD40 repeat 191..219 CDD:293791
WD40 repeat 226..277 CDD:293791
WD40 repeat 283..326 CDD:293791
cyclophilin_WD40 495..643 CDD:238908 77/152 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.