DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and Ranbp2

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:XP_038954525.1 Gene:Ranbp2 / 294429 RGDID:1560047 Length:3114 Species:Rattus norvegicus


Alignment Length:139 Identity:80/139 - (57%)
Similarity:103/139 - (74%) Gaps:0/139 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRIIKDFMIQGGDFTKG 95
            ||||:.:.|||.|||.:.||...||:|.|||:.|....:|.|:|.|.|||::.||:.||||.||.
  Rat  2956 VFFDVCVDGEPLGRIIMELFSNIVPQTAENFRALCTGEKGFGFKNSIFHRVVPDFICQGGDITKY 3020

  Fly    96 DGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVVFGKILSG 160
            :||||:||||::|:||||.|||.|.|.|||||.|::||.||||||.|:...||.:|||||.:..|
  Rat  3021 NGTGGQSIYGDKFDDENFDLKHTGPGLLSMANCGQNTNSSQFFITLKKAEHLDFKHVVFGFVKDG 3085

  Fly   161 MNVVRQIEN 169
            |:.||:||:
  Rat  3086 MDTVRKIES 3094

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 80/139 (58%)
Ranbp2XP_038954525.1 TPR <18..126 CDD:223533
TPR repeat 59..89 CDD:276809
RanBD1_RanBP2-like 1180..1296 CDD:270203
zf-RanBP 1345..1374 CDD:395516
RanBP2-type Zn finger 1350..1369 CDD:275375
zf-RanBP 1410..1438 CDD:395516
RanBP2-type Zn finger 1414..1433 CDD:275375
zf-RanBP 1473..1502 CDD:395516
RanBP2-type Zn finger 1477..1496 CDD:275375
zf-RanBP 1533..1563 CDD:395516
RanBP2-type Zn finger 1537..1556 CDD:275375
zf-RanBP 1596..1625 CDD:395516
RanBP2-type Zn finger 1600..1619 CDD:275375
zf-RanBP 1655..1683 CDD:395516
RanBP2-type Zn finger 1659..1678 CDD:275375
RanBD2_RanBP2-like 1902..2018 CDD:269998
RanBD3_RanBP2-like 2199..2315 CDD:270204
IR1-M 2529..2590 CDD:403422
IR1-M 2605..2663 CDD:403422
RanBD4_RanBP2-like 2815..2931 CDD:269999
cyclophilin_ABH_like 2954..3112 CDD:238907 80/139 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.