DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and Ppic

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001004215.1 Gene:Ppic / 291463 RGDID:1303221 Length:212 Species:Rattus norvegicus


Alignment Length:206 Identity:126/206 - (61%)
Similarity:145/206 - (70%) Gaps:5/206 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KLFLSVFVVALVAGVVVADDS-----KGPKVTEKVFFDITIGGEPAGRIEIGLFGKTVPKTVENF 61
            :|.|...:...:.|:|.:..|     :||.||:|||||:.||.:..|||.||||||.||:|||||
  Rat     6 RLLLPAVLFLGLGGLVSSSGSSGVRKRGPLVTDKVFFDVRIGDKDVGRIVIGLFGKVVPRTVENF 70

  Fly    62 KELALKPQGEGYKGSKFHRIIKDFMIQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMA 126
            ..||...:|.|||||.|||:||||||||||||..|||||.|||||.|.||||||||||.||:|||
  Rat    71 VTLATGEKGYGYKGSIFHRVIKDFMIQGGDFTARDGTGGMSIYGETFPDENFKLKHYGIGWVSMA 135

  Fly   127 NAGKDTNGSQFFITTKQTSWLDGRHVVFGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTLP 191
            |||.||||||||||..:.:||||:||||||:|.||.||..||..|||..|||:.|..|.|||.:.
  Rat   136 NAGPDTNGSQFFITLTKPAWLDGKHVVFGKVLDGMTVVHSIELQATDDHDRPLTDCTIVNSGKID 200

  Fly   192 VSEAFSVAKAD 202
            |...|.|...|
  Rat   201 VKTPFVVEVPD 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 111/157 (71%)
PpicNP_001004215.1 cyclophilin_ABH_like 38..197 CDD:238907 111/158 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100844
Panther 1 1.100 - - O PTHR11071
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X987
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.790

Return to query results.
Submit another query.