DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and PPIL6

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001104768.2 Gene:PPIL6 / 285755 HGNCID:21557 Length:337 Species:Homo sapiens


Alignment Length:191 Identity:70/191 - (36%)
Similarity:95/191 - (49%) Gaps:34/191 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEG-------YKGSKFHRIIKDFMIQ 88
            ||.||.|...|.||:...|:....|||.:||:.|.....|..       ||.|.||||:::..||
Human   144 VFLDICIDSSPIGRLIFELYCDVCPKTCKNFQVLCTGKAGFSQRGIRLHYKNSIFHRIVQNGWIQ 208

  Fly    89 GGDFTKGDGTGGRSIYG--------------------------ERFEDENFKLKHYGAGWLSMAN 127
            |||...|.|..|.||||                          |::.||||.:.|...|.|.|||
Human   209 GGDIVYGKGDNGESIYGPTFEELYGSLKRSVKRQKESRGVGKIEKYRDENFSVPHNKRGVLGMAN 273

  Fly   128 AGKDTNGSQFFITTKQTSWLDGRHVVFGKILSGMNVVRQIENSATDARDRPVKDVVIANSG 188
            .|:.:|||||:||.:.|.:||.:.|.||:::.|..|::|:|...|. .:||:....|.:||
Human   274 KGRHSNGSQFYITLQATPYLDRKFVAFGQLIEGTEVLKQLELVPTQ-NERPIHMCRITDSG 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 68/189 (36%)
PPIL6NP_001104768.2 cyclophilin 144..333 CDD:412213 68/189 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.