DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and wis2

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_594787.1 Gene:wis2 / 2542541 PomBaseID:SPAC1B3.03c Length:356 Species:Schizosaccharomyces pombe


Alignment Length:177 Identity:97/177 - (54%)
Similarity:117/177 - (66%) Gaps:6/177 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEG----YKGSKFHRIIKDFMIQGGDF 92
            :|.|:|.|:....|...||...|||||:||..|....:.:|    ||||:|||:||:||:|||||
pombe     6 YFKISIDGKIQPTIYFELFDNVVPKTVKNFASLCNGFEKDGRCLTYKGSRFHRVIKNFMLQGGDF 70

  Fly    93 TKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVVFGKI 157
            |:|:||||.|||||:||||||:|||.....|||||||.:||||||||||..|..|||:||||||:
pombe    71 TRGNGTGGESIYGEKFEDENFELKHDKPFLLSMANAGPNTNGSQFFITTVPTPHLDGKHVVFGKV 135

  Fly   158 LSGMNVVRQIENSATDARDRPVKDVVIANSGTLPVSEAFSVAKADAT 204
            :.|.:.||.|||..| ..|.||..|||...||. ..:.....|.|.|
pombe   136 IQGKSTVRTIENLET-KNDDPVVPVVIEECGTC-TKDQIEAPKPDVT 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 92/159 (58%)
wis2NP_594787.1 cyclophilin 6..165 CDD:294131 92/159 (58%)
TPR_11 204..287 CDD:290150
TPR repeat 204..253 CDD:276809
TPR repeat 258..288 CDD:276809
TPR_11 261..323 CDD:290150
TPR repeat 293..323 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.