DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and wis2

DIOPT Version :10

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_594787.1 Gene:wis2 / 2542541 PomBaseID:SPAC1B3.03C Length:356 Species:Schizosaccharomyces pombe


Alignment Length:177 Identity:97/177 - (54%)
Similarity:117/177 - (66%) Gaps:6/177 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEG----YKGSKFHRIIKDFMIQGGDF 92
            :|.|:|.|:....|...||...|||||:||..|....:.:|    ||||:|||:||:||:|||||
pombe     6 YFKISIDGKIQPTIYFELFDNVVPKTVKNFASLCNGFEKDGRCLTYKGSRFHRVIKNFMLQGGDF 70

  Fly    93 TKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVVFGKI 157
            |:|:||||.|||||:||||||:|||.....|||||||.:||||||||||..|..|||:||||||:
pombe    71 TRGNGTGGESIYGEKFEDENFELKHDKPFLLSMANAGPNTNGSQFFITTVPTPHLDGKHVVFGKV 135

  Fly   158 LSGMNVVRQIENSATDARDRPVKDVVIANSGTLPVSEAFSVAKADAT 204
            :.|.:.||.|||..| ..|.||..|||...||. ..:.....|.|.|
pombe   136 IQGKSTVRTIENLET-KNDDPVVPVVIEECGTC-TKDQIEAPKPDVT 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:469651 92/159 (58%)
wis2NP_594787.1 cyclophilin 6..165 CDD:469651 92/159 (58%)
TPR repeat 204..253 CDD:276809
Spy 210..>323 CDD:443119
TPR repeat 258..288 CDD:276809
TPR repeat 293..323 CDD:276809
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.