DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and ppi1

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_595664.1 Gene:ppi1 / 2540269 PomBaseID:SPBC28F2.03 Length:162 Species:Schizosaccharomyces pombe


Alignment Length:164 Identity:93/164 - (56%)
Similarity:114/164 - (69%) Gaps:11/164 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRIIKDFMIQGGDFTKGD 96
            |||:...|:|.|||...||...||||..||:.|....:|.||.||.|||:|..||:||||||:|:
pombe     5 FFDVIANGQPLGRIVFKLFDDVVPKTAANFRALCTGEKGYGYAGSTFHRVIPQFMLQGGDFTRGN 69

  Fly    97 GTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVVFGKILSGM 161
            ||||:|||||:|.||||.|||...|.|||||||.:||||||||||..|.||||:|||||::..||
pombe    70 GTGGKSIYGEKFPDENFALKHNKPGLLSMANAGPNTNGSQFFITTVVTPWLDGKHVVFGEVTEGM 134

  Fly   162 NVVRQIE-----NSATDARDRPVKDVVIANSGTL 190
            :||:::|     :.||.||      :||...||:
pombe   135 DVVKKVESLGSNSGATRAR------IVIDKCGTV 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 91/160 (57%)
ppi1NP_595664.1 cyclophilin_ABH_like 2..160 CDD:238907 91/160 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.