DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and cyp3

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_595437.1 Gene:cyp3 / 2540198 PomBaseID:SPBC1709.04c Length:173 Species:Schizosaccharomyces pombe


Alignment Length:167 Identity:88/167 - (52%)
Similarity:110/167 - (65%) Gaps:7/167 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VFFDITIGGEPAGRIEIGLFGKTVPKTVENFKE------LALKPQGEGYKGSKFHRIIKDFMIQG 89
            ||.||.|.|...|||:|.||...||||.|||::      |.:..:..|||.|.|||||:.|||||
pombe     7 VFMDIAIDGRLLGRIKIRLFSSIVPKTAENFRQFCTGETLGVNQKPIGYKNSTFHRIIQGFMIQG 71

  Fly    90 GDFTKGDGTGGRSIYGER-FEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVV 153
            |||..|||||..:|:..| |.||||.|||...|.|||||||||:||.||||||....:|||:|||
pombe    72 GDFVSGDGTGSATIFNSRTFPDENFTLKHDRPGLLSMANAGKDSNGCQFFITTVPCDFLDGKHVV 136

  Fly   154 FGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTL 190
            ||:::.|.::|::||::...|..||..:|.|...|.:
pombe   137 FGEVIEGYDIVKEIESTPVGANSRPKSNVAIVECGEM 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 87/163 (53%)
cyp3NP_595437.1 cyclophilin_ABH_like 5..171 CDD:238907 87/163 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.