DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and CG32236

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster


Alignment Length:177 Identity:33/177 - (18%)
Similarity:66/177 - (37%) Gaps:38/177 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VFFDITI--GGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRIIKDF-------- 85
            ::||:.:  ..:..||:.:.|:.:..|:.|..|..:|.      :.....||.::.|        
  Fly   230 IYFDMAVRENNQFMGRLLLQLYTELSPEVVLEFVRMAT------HNDVGCHRFVRIFSNLWMEAE 288

  Fly    86 -------MIQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQ 143
                   .:......|........|.|......::: :|:..|.||            :.|:.||
  Fly   289 LVPAVHDSLHNHHSVKYSFLDPSKITGVLSYPWDYR-RHFPQGLLS------------YTISFKQ 340

  Fly   144 TSWLDGRHVVFGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTL 190
             |.:..:.|:||::..|:.|::......| ...:..|.|::...|.|
  Fly   341 -SVIPWQRVIFGRVCGGLRVLQNCHEFGT-KNGKTKKTVIVTRCGLL 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 31/173 (18%)
CG32236NP_729026.1 KIAA1430 85..177 CDD:290590
cyclophilin 227..385 CDD:294131 32/175 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.