DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and CG32236

DIOPT Version :10

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster


Alignment Length:177 Identity:33/177 - (18%)
Similarity:66/177 - (37%) Gaps:38/177 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VFFDITI--GGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRIIKDF-------- 85
            ::||:.:  ..:..||:.:.|:.:..|:.|..|..:|.      :.....||.::.|        
  Fly   230 IYFDMAVRENNQFMGRLLLQLYTELSPEVVLEFVRMAT------HNDVGCHRFVRIFSNLWMEAE 288

  Fly    86 -------MIQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQ 143
                   .:......|........|.|......::: :|:..|.||            :.|:.||
  Fly   289 LVPAVHDSLHNHHSVKYSFLDPSKITGVLSYPWDYR-RHFPQGLLS------------YTISFKQ 340

  Fly   144 TSWLDGRHVVFGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTL 190
             |.:..:.|:||::..|:.|::......| ...:..|.|::...|.|
  Fly   341 -SVIPWQRVIFGRVCGGLRVLQNCHEFGT-KNGKTKKTVIVTRCGLL 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:469651 31/173 (18%)
CG32236NP_729026.1 Hmw_CFAP97 86..177 CDD:464014
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.