DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and CG30350

DIOPT Version :10

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster


Alignment Length:149 Identity:31/149 - (20%)
Similarity:62/149 - (41%) Gaps:16/149 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KVFFDITI-GGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKF--HRIIKDFMIQGGD 91
            :::||:.: ...|.||..:.|:.:..|..|....:..:..|     .|||  .|:..:..::...
  Fly   214 RIYFDLYLKDARPLGRFVVQLYTEAAPLVVLQLIKSCMCNQ-----HSKFMVKRLFPNLWLETDL 273

  Fly    92 FTKGDGTGGRSIYGERFEDENFKLKHYGAGWL---SMANAGKDTNGSQFFITTKQTSWLDGRHVV 153
            ....|     |:..:..|.:...:.|..:.::   |.|.....|:...|.|:.|..:.::|..|.
  Fly   274 MLSSD-----SLLHQPLEYDAKVIDHGASSYVLSFSKAYVTGFTHHLSFAISFKPLTVVNGSRVG 333

  Fly   154 FGKILSGMNVVRQIENSAT 172
            ||:|:.|..:...|::..|
  Fly   334 FGRIVKGSKICECIQSYGT 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:469651 31/149 (21%)
CG30350NP_724715.1 Hmw_CFAP97 61..155 CDD:464014
Pro_isomerase 227..367 CDD:459694 28/136 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.