Sequence 1: | NP_611695.1 | Gene: | CG2852 / 37591 | FlyBaseID: | FBgn0034753 | Length: | 205 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011528343.1 | Gene: | PPIL2 / 23759 | HGNCID: | 9261 | Length: | 616 | Species: | Homo sapiens |
Alignment Length: | 145 | Identity: | 65/145 - (44%) |
---|---|---|---|
Similarity: | 94/145 - (64%) | Gaps: | 8/145 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 43 GRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRIIKDFMIQGGDFTKGDGTGGRSIYGER 107
Fly 108 FEDENFK--LKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVVFGKILSGMNVVRQIENS 170
Fly 171 ATDAR-DRPVKDVVI 184 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG2852 | NP_611695.1 | cyclophilin | 30..188 | CDD:294131 | 65/145 (45%) |
PPIL2 | XP_011528343.1 | RING-Ubox_PPIL2 | 38..110 | CDD:319577 | |
RING_Ubox | 100..159 | CDD:388418 | |||
U-box domain, a modified RING finger | 103..146 | CDD:319361 | |||
cyclophilin_RING | 281..440 | CDD:238904 | 65/145 (45%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0652 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |