DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and PPWD1

DIOPT Version :10

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_056157.1 Gene:PPWD1 / 23398 HGNCID:28954 Length:646 Species:Homo sapiens


Alignment Length:115 Identity:31/115 - (26%)
Similarity:48/115 - (41%) Gaps:29/115 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 EQYNITDA---NLWKNLTLPRET-DNRGQLGYSKCQMYNITEQHLQ------RHYSEWSFAS-SD 114
            |::.:.||   :|:|.:.:  || .|...:||| .:.:.| |.|.|      ||....|... |:
Human    35 EEWALLDASQKSLYKGVMV--ETYRNLTAIGYS-WEEHTI-EDHFQTSRSLGRHERRSSAEQHSE 95

  Fly   115 IIDC--AYGYEYDRTYYDRTPITEYDWICDKGFRETNIFIYNRLGELFGT 162
            .|.|  |:.|:.....:.|....|..:.|            |:.|:.|||
Human    96 FIPCGKAFAYQSRSQRHVRIHNGEKHYEC------------NQCGKDFGT 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:469651 31/115 (27%)
PPWD1NP_056157.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
WD 1 80..118 9/37 (24%)
WD40 <89..319 CDD:441893 14/57 (25%)
WD 2 124..162 6/22 (27%)
WD40 repeat 136..177 CDD:293791
WD 3 168..208
WD40 repeat 191..219 CDD:293791
WD 4 213..252
WD40 repeat 226..277 CDD:293791
WD 5 271..309
WD40 repeat 283..326 CDD:293791
WD 6 345..386
WD 7 401..453
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 455..490
cyclophilin_WD40 495..643 CDD:238908
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.