DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and Ppib

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_035279.2 Gene:Ppib / 19035 MGIID:97750 Length:216 Species:Mus musculus


Alignment Length:204 Identity:135/204 - (66%)
Similarity:163/204 - (79%) Gaps:10/204 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VFVVALVAGVVV----------ADDSKGPKVTEKVFFDITIGGEPAGRIEIGLFGKTVPKTVENF 61
            :|..||:.|.||          .|..||||||.||:||:.||.|..||:..|||||||||||:||
Mouse    12 LFAAALIVGSVVFLLLPGPSVANDKKKGPKVTVKVYFDLQIGDESVGRVVFGLFGKTVPKTVDNF 76

  Fly    62 KELALKPQGEGYKGSKFHRIIKDFMIQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMA 126
            ..||...:|.|||.|||||:||||||||||||:||||||:|||||||.||||||||||.||:|||
Mouse    77 VALATGEKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMA 141

  Fly   127 NAGKDTNGSQFFITTKQTSWLDGRHVVFGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTLP 191
            |||||||||||||||.:||||||:||||||:|.||:|||::|::.||:||:|:|||:|.:||.:.
Mouse   142 NAGKDTNGSQFFITTVKTSWLDGKHVVFGKVLEGMDVVRKVESTKTDSRDKPLKDVIIVDSGKIE 206

  Fly   192 VSEAFSVAK 200
            |.:.|::||
Mouse   207 VEKPFAIAK 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 116/157 (74%)
PpibNP_035279.2 cyclophilin_ABH_like 45..203 CDD:238907 116/157 (74%)
Prevents secretion from ER. /evidence=ECO:0000250 213..216 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 250 1.000 Domainoid score I2109
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H726
Inparanoid 1 1.050 284 1.000 Inparanoid score I2845
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 1 1.000 - - oto92790
orthoMCL 1 0.900 - - OOG6_100844
Panther 1 1.100 - - LDO PTHR11071
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R961
SonicParanoid 1 1.000 - - X987
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.870

Return to query results.
Submit another query.