DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and cyn-7

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_506749.1 Gene:cyn-7 / 180027 WormBaseID:WBGene00000883 Length:171 Species:Caenorhabditis elegans


Alignment Length:168 Identity:94/168 - (55%)
Similarity:124/168 - (73%) Gaps:8/168 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEG-------YKGSKFHRIIKDFMI 87
            :|||||||.|:|.|||.:.|:...||||.|||:.|....:|.|       :|||||||||.:|||
 Worm     5 RVFFDITIAGKPTGRIVMELYNDIVPKTAENFRALCTGEKGVGKSGKPLHFKGSKFHRIIPEFMI 69

  Fly    88 QGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHV 152
            ||||||:|:||||.|||||:|.|||||.||.|.|.|||||||.:|||||||:.|.:|:||||:||
 Worm    70 QGGDFTRGNGTGGESIYGEKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTAWLDGKHV 134

  Fly   153 VFGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTL 190
            |||:::.|:::|.::|.:.:.: ..|..:.:||:.|.|
 Worm   135 VFGRVVEGLDIVSKVEGNGSSS-GTPKSECLIADCGQL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 92/164 (56%)
cyn-7NP_506749.1 cyclophilin_ABH_like 4..169 CDD:238907 92/164 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.