DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and cyn-9

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_497745.1 Gene:cyn-9 / 175471 WormBaseID:WBGene00000885 Length:309 Species:Caenorhabditis elegans


Alignment Length:170 Identity:85/170 - (50%)
Similarity:112/170 - (65%) Gaps:8/170 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EKVFFDITIGGEPAGRIEIGLFGKTVPKTVENFK-----ELALKPQGEG---YKGSKFHRIIKDF 85
            ::||.||::.....|||||.||.:..|||.|||:     |:.:.|..:.   ||.::||||:|.|
 Worm     5 KRVFLDISVDENLIGRIEIRLFVEDAPKTCENFRALCTGEVGMTPNNKARLHYKQNEFHRIVKKF 69

  Fly    86 MIQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGR 150
            ||||||.|:|||.||.||||..|:||.|||||.....|||||.|.::|.|||||||......:|:
 Worm    70 MIQGGDITEGDGRGGFSIYGRYFDDEKFKLKHSRPYLLSMANKGPNSNSSQFFITTAAAPHCNGK 134

  Fly   151 HVVFGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTL 190
            |||||:::.|.|||..|:|.|.|.:.:|:..|:|:|.|.|
 Worm   135 HVVFGEVVKGQNVVDYIDNLAVDDKSKPLAKVLISNCGEL 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 83/165 (50%)
cyn-9NP_497745.1 cyclophilin 6..172 CDD:294131 83/165 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.