Sequence 1: | NP_611695.1 | Gene: | CG2852 / 37591 | FlyBaseID: | FBgn0034753 | Length: | 205 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_496337.1 | Gene: | cyn-4 / 174674 | WormBaseID: | WBGene00000880 | Length: | 523 | Species: | Caenorhabditis elegans |
Alignment Length: | 197 | Identity: | 73/197 - (37%) |
---|---|---|---|
Similarity: | 103/197 - (52%) | Gaps: | 13/197 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 AGVVVADDSKGPKVTEKVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEG-YKGSK 77
Fly 78 FHRIIKDFMIQGGDFTKGDGTGGRSIYGERFEDENFK-LKHYGAGWLSMANAGKDTNGSQFFITT 141
Fly 142 KQTSWLDGRHVVFGKILSGMNVVRQIENSAT-DARDRPVKDVVIANSGTL--PVSEAFSVAKADA 203
Fly 204 TD 205 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG2852 | NP_611695.1 | cyclophilin | 30..188 | CDD:294131 | 65/160 (41%) |
cyn-4 | NP_496337.1 | Ubox | 45..96 | CDD:128780 | |
cyclophilin_RING | 281..440 | CDD:238904 | 66/166 (40%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0652 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |