DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and cyn-4

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_496337.1 Gene:cyn-4 / 174674 WormBaseID:WBGene00000880 Length:523 Species:Caenorhabditis elegans


Alignment Length:197 Identity:73/197 - (37%)
Similarity:103/197 - (52%) Gaps:13/197 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AGVVVADDSKGPKVTEKVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEG-YKGSK 77
            |.|:..|..:..:|.:..|..:...   .|.:.:.||...|||..|||    :.....| |..:|
 Worm   263 AAVLDNDTVRYSRVKKNAFVRLVTN---FGPLNLELFAPKVPKACENF----ITHCSNGYYNNTK 320

  Fly    78 FHRIIKDFMIQGGDFTKGDGTGGRSIYGERFEDENFK-LKHYGAGWLSMANAGKDTNGSQFFITT 141
            |||:||:||:||||.| |.|.||.||:.:.|.||... ..|...|.|||||.|.:|||||||||.
 Worm   321 FHRLIKNFMLQGGDPT-GTGHGGESIWDKPFSDEFISGFSHDARGVLSMANKGSNTNGSQFFITF 384

  Fly   142 KQTSWLDGRHVVFGKILSGMNVVRQIENSAT-DARDRPVKDVVIANSGTL--PVSEAFSVAKADA 203
            :...:||.:|.:||:::.|.:.:..||...| :..|.|:..|||..:...  |..||....:|:.
 Worm   385 RPCKYLDRKHTIFGRLVGGQDTLTTIEKLETEEGTDVPMVSVVIMRAEVFVDPFEEAEKEVQAER 449

  Fly   204 TD 205
            .:
 Worm   450 AE 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 65/160 (41%)
cyn-4NP_496337.1 Ubox 45..96 CDD:128780
cyclophilin_RING 281..440 CDD:238904 66/166 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.