DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and cyn-10

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001021890.1 Gene:cyn-10 / 174132 WormBaseID:WBGene00000886 Length:161 Species:Caenorhabditis elegans


Alignment Length:146 Identity:64/146 - (43%)
Similarity:84/146 - (57%) Gaps:5/146 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 AGRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRIIKDFMIQGGDFTKGDGTGGRSIYGE 106
            :|.|:|.|:....||..|||..|.   ..:.|.|..|||.|||||:|.||.|. .|.||.||:|.
 Worm     9 SGDIKIELYVDDAPKACENFLALC---ASDYYNGCIFHRNIKDFMVQTGDPTH-SGKGGESIWGG 69

  Fly   107 RFEDENFK-LKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVVFGKILSGMNVVRQIENS 170
            .||||... |||...|.:||||.|.|:|.||||||..:.:.||.::.:|||::.|.:.:.:||..
 Worm    70 PFEDEFVSALKHDSRGCVSMANNGPDSNRSQFFITYAKQAHLDMKYTLFGKVIDGFDTLEEIETI 134

  Fly   171 ATDARDRPVKDVVIAN 186
            ..|.:.||:....|.|
 Worm   135 KVDNKYRPLVQQKIQN 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 64/146 (44%)
cyn-10NP_001021890.1 Cyclophilin_PPIL3_like 1..153 CDD:238909 64/146 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.