DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and cyn-5

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001379232.1 Gene:cyn-5 / 173374 WormBaseID:WBGene00000881 Length:204 Species:Caenorhabditis elegans


Alignment Length:200 Identity:142/200 - (71%)
Similarity:160/200 - (80%) Gaps:0/200 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFLSVFVVALVAGVVVADDSKGPKVTEKVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELA 65
            ||..|.|..|..|..:...||:||||||:||:||:.|||:|.|||.|||||||||||..||.|||
 Worm     1 MKSLLVVAAVLAVGALAQGDDAKGPKVTDKVYFDMEIGGKPIGRIVIGLFGKTVPKTATNFIELA 65

  Fly    66 LKPQGEGYKGSKFHRIIKDFMIQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGK 130
            .||:||||.||||||:|.||||||||||:||||||||||||:|.||||||||||||||||||||.
 Worm    66 KKPKGEGYPGSKFHRVIADFMIQGGDFTRGDGTGGRSIYGEKFADENFKLKHYGAGWLSMANAGA 130

  Fly   131 DTNGSQFFITTKQTSWLDGRHVVFGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTLPVSEA 195
            |||||||||||.:|.|||||||||||||.||:|||:||.:.....|||.:||:||.||.:.|...
 Worm   131 DTNGSQFFITTVKTPWLDGRHVVFGKILEGMDVVRKIEQTEKLPGDRPKQDVIIAASGHIAVDTP 195

  Fly   196 FSVAK 200
            |||.:
 Worm   196 FSVER 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 122/157 (78%)
cyn-5NP_001379232.1 cyclophilin 29..188 CDD:412213 122/158 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167452
Domainoid 1 1.000 253 1.000 Domainoid score I1124
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H726
Inparanoid 1 1.050 290 1.000 Inparanoid score I1694
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 1 1.000 - - otm14535
orthoMCL 1 0.900 - - OOG6_100844
Panther 1 1.100 - - LDO PTHR11071
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R961
SonicParanoid 1 1.000 - - X987
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1615.840

Return to query results.
Submit another query.