DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and Ppif

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_598845.1 Gene:Ppif / 105675 MGIID:2145814 Length:206 Species:Mus musculus


Alignment Length:188 Identity:96/188 - (51%)
Similarity:120/188 - (63%) Gaps:4/188 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFLSVFVVALVAGVVVADDSKGPKVTEKVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALK 67
            |.||........|...|:.|.|..:   |:.|:...|:|.||:.:.|....||||.|||:.|...
Mouse    22 LLLSATRTCSDGGARGANSSSGNPL---VYLDVGADGQPLGRVVLELKADVVPKTAENFRALCTG 83

  Fly    68 PQGEGYKGSKFHRIIKDFMIQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDT 132
            .:|.|||||.|||:|..||.|.||||..:|||||||||.||.||||.|||.|.|.|||||||.:|
Mouse    84 EKGFGYKGSTFHRVIPAFMCQAGDFTNHNGTGGRSIYGSRFPDENFTLKHVGPGVLSMANAGPNT 148

  Fly   133 NGSQFFITTKQTSWLDGRHVVFGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTL 190
            |||||||.|.:|.||||:|||||.:..||:||::||:..:.: .:..|.:||.:.|.|
Mouse   149 NGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKS-GKTSKKIVITDCGQL 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 87/157 (55%)
PpifNP_598845.1 cyclophilin_ABH_like 45..203 CDD:238907 87/161 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.