DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and LOC100909955

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:XP_038936344.1 Gene:LOC100909955 / 100909955 RGDID:6501070 Length:187 Species:Rattus norvegicus


Alignment Length:162 Identity:80/162 - (49%)
Similarity:99/162 - (61%) Gaps:1/162 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VTEKVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRIIKDFMIQGGD 91
            |...|:|:||..|||.|.:...||...||||.|||..|:...:|.|||.|.|||||..||.|||:
  Rat    25 VNPTVYFNITADGEPLGHVSFELFADNVPKTAENFHALSTGEKGFGYKASSFHRIIPGFMCQGGN 89

  Fly    92 FTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVVFGK 156
            .|..:|.||||||.|:||.|:..|||.|.|.|||||...:|:||||||.|.:|.||.|:.|||.|
  Rat    90 VTCHNGAGGRSIYREKFEGEDVILKHTGPGILSMANDEPNTSGSQFFICTAKTEWLGGKGVVFEK 154

  Fly   157 ILSGMNVVRQIENSATDARDRPVKDVVIANSG 188
            ...|||:|..:|...: ...:..|.:.|:..|
  Rat   155 AKDGMNIVEAMERFGS-RNGKTSKQITISGCG 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 78/157 (50%)
LOC100909955XP_038936344.1 cyclophilin 27..185 CDD:412213 78/158 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.