DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and ppic

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:XP_002931773.2 Gene:ppic / 100494684 XenbaseID:XB-GENE-948735 Length:208 Species:Xenopus tropicalis


Alignment Length:183 Identity:123/183 - (67%)
Similarity:141/183 - (77%) Gaps:0/183 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KGPKVTEKVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRIIKDFMI 87
            :||.||.||||::.|||..||||.||||||.|||||:||..||...:|.|||||:|||:||||||
 Frog    26 RGPVVTAKVFFNVEIGGTDAGRIVIGLFGKVVPKTVKNFVALATGEKGYGYKGSRFHRVIKDFMI 90

  Fly    88 QGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHV 152
            ||||.|.||||||:|||||.|.||||||||||.||:||||||.|||||||||:|.:..||:|:||
 Frog    91 QGGDVTNGDGTGGKSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFISTTRPLWLNGKHV 155

  Fly   153 VFGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTLPVSEAFSVAKADATD 205
            ||||:|.||.||..||...|:.||:|:||.||.|||.:.|.|.|.|...|..|
 Frog   156 VFGKVLEGMAVVHLIELQQTNERDQPLKDCVIVNSGVVTVKEPFVVEVDDWQD 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 111/157 (71%)
ppicXP_002931773.2 cyclophilin 33..191 CDD:294131 111/157 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X987
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.