DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and Ppial4d

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:XP_006250863.1 Gene:Ppial4d / 100360977 RGDID:2321083 Length:164 Species:Rattus norvegicus


Alignment Length:164 Identity:96/164 - (58%)
Similarity:116/164 - (70%) Gaps:1/164 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VTEKVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRIIKDFMIQGGD 91
            |...||||||..|||.||:...||...||||.|||:.|:...:|.|||||.|||||..||.||||
  Rat     2 VNPTVFFDITADGEPLGRVCFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGD 66

  Fly    92 FTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVVFGK 156
            ||:.:||||:|||||:||||||.|||.|.|.|||||||.:||||||||.|.:|.||||:||||||
  Rat    67 FTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGK 131

  Fly   157 ILSGMNVVRQIENSATDARDRPVKDVVIANSGTL 190
            :..||::|..:|...: ...:..|.:.|::.|.|
  Rat   132 VKEGMSIVEAMERFGS-RNGKTSKKITISDCGQL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 93/157 (59%)
Ppial4dXP_006250863.1 cyclophilin_ABH_like 4..162 CDD:238907 93/158 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.