DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt317A1 and Ugt1a6a

DIOPT Version :9

Sequence 1:NP_001286734.1 Gene:Ugt317A1 / 37590 FlyBaseID:FBgn0040091 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_659545.2 Gene:Ugt1a6a / 94284 MGIID:2137698 Length:531 Species:Mus musculus


Alignment Length:568 Identity:136/568 - (23%)
Similarity:233/568 - (41%) Gaps:102/568 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 WILLAILGLALGQISQAAKILVLFPHVNEGHFAVMRTLVTELANREHTIEVYTGHG---LGES-- 67
            ::.|.:....||.     |:||: |. :..|:..|:.:|..|:.|.|.|.|.....   ||||  
Mouse    15 FLFLVLWASVLGD-----KLLVV-PQ-DGSHWLSMKEIVEHLSERGHDIMVLVPEVNLLLGESKY 72

  Fly    68 ----LDNVTETVTAEFPFWSELQKQAAPKGN---LADLGLL-PIEKLRQSLASVGARALDHFLAQ 124
                :.:||.::       .|||.:....||   |....|: |:.:.|.::..|     |.|.:.
Mouse    73 YRRKIFSVTYSL-------EELQTRFRTFGNNHFLPGASLMGPLREYRNNMIVV-----DMFFSN 125

  Fly   125 EPIQKLLK----MSYL-EFDFDVILVDYFYTEALLALGALHQRPVV--GIISTDFGN----YM-- 176
              .|.|||    :|:| |..||.:..|                |.:  |:|..::.|    |:  
Mouse   126 --CQSLLKDSATLSFLRENKFDALFTD----------------PAMPCGVILAEYLNLPSVYLFR 172

  Fly   177 --DAVQEALVPAACSPID-----FERDQPEMSFSVRLGN---------IRTCIARRKQFIKDHYG 225
              ....|.::..:.||:.     :.:....|:|..||.|         :..|:          |.
Mouse   173 GFPCSLEHMLGQSPSPVSYVPRFYTKFSDHMTFPQRLANFIVNILENYLYYCL----------YS 227

  Fly   226 GQEQLVTKYFQLQSSIPELQASQLSVLLLNSHVPLITPKVSIQQIIPAGGLHIRGPKELPWNVKR 290
            ..|.:.:...:...|:|.|.  |.|:.||........|:..:..:|..||::.:...:|....:.
Mouse   228 KYEIIASDLLKRDVSLPSLH--QNSLWLLRYDFVFEYPRPVMPNMIFLGGINCKKKGKLTQEFEA 290

  Fly   291 FLE-EARPGAIYVQLGNEQACGQLPKEKLDTLFAFFSARKQSIIWTCHDVKTLEGLPKNVMIQHA 354
            ::. ....|.:...||:  ...::|::|...:........|:::|.....:. ..|.||.::...
Mouse   291 YVNASGEHGIVVFSLGS--MVSEIPEKKAMEIAEALGRIPQTVLWRYTGTRP-SNLAKNTILVKW 352

  Fly   355 VPQIDILAHPRVKAFLTNGDLLNLQEGIMRNVPILGLPLFQHEARNMELAVRLGVGLQLEEGNVT 419
            :||.|:|.||:.:||:|:.....:.|||...||::.:|||..:..|.:.....|.|:.|....:|
Mouse   353 LPQNDLLGHPKTRAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMT 417

  Fly   420 TESLNWAVDRLLLESHFQLTIRDVSLEFRDRPLGALASALFWVNYVARHKGGSALRTRGIGISSC 484
            .:.|..|:..::....::..|..:|...:|||:..|..|:|||.||.||||...||.....::..
Mouse   418 ADDLENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLTWY 482

  Fly   485 QLHLFDLFVFYAGIATLVVSLLVAL-------SFGGFYIWNKKNNSKS 525
            |.|..|:..|...|...||.::...       .|||.....|.:.||:
Mouse   483 QYHSLDVIGFLLAIVLTVVFIVFKCCAYGCRKCFGGKGRVKKSHKSKT 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt317A1NP_001286734.1 Glycosyltransferase_GTB_type 22..477 CDD:299143 120/497 (24%)
UDPGT 25..514 CDD:278624 129/538 (24%)
Ugt1a6aNP_659545.2 egt 15..503 CDD:223071 130/539 (24%)
UDPGT 27..522 CDD:278624 130/546 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BDT1
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.